PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 907451
Common NameARALYDRAFT_907451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family FAR1
Protein Properties Length: 252aa    MW: 28839.3 Da    PI: 6.2918
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
907451genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR195.18.5e-3085172291
    FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
             fYn+YA++vGF +r+sk ++s+++g+ + r++vC+keg+r ++k++  k  r+raetr+gCka++ ++ke++gkw++tk+++eHnH+l+p
  907451  85 FYNAYATKVGFVIRVSKLSRSRHDGSPIGRQLVCNKEGYRLPSKRD--KVIRQRAETRVGCKAMILIRKENSGKWVITKFVKEHNHSLMP 172
             9******************************************999..999************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.3E-2785172IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MMMGIPVELE VTTVENHNEM GESSGQAMIE QDDDNHNELG ENSGEQDEKV DPDSIPLAVA  60
DMTEAQGDEP YVGQEFESEA AAHGFYNAYA TKVGFVIRVS KLSRSRHDGS PIGRQLVCNK  120
EGYRLPSKRD KVIRQRAETR VGCKAMILIR KENSGKWVIT KFVKEHNHSL MPGRVRRGCI  180
YDQYPNEHDK IQELMQQLAA EKKRAATYKR HLEMLFEQIE QHNESLSKRI QHIVDNVRNL  240
EQRDHQQNQQ V*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0580890.0AY058089.1 Arabidopsis thaliana AT3g59470/T16L24_20 mRNA, complete cds.
GenBankAY1430810.0AY143081.1 Arabidopsis thaliana At3g59470/T16L24_20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002878273.10.0far-red impaired responsive family protein
TrEMBLD7LWD60.0D7LWD6_ARALL; Far-red impaired responsive family protein
STRINGscaffold_503155.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73022539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.20.0FAR1 family protein